* Posts by Nigel 11

2580 posts • joined 10 Jun 2009

US Supremes: Human genes can't be patented

Nigel 11
Silver badge

Re: Hmmm

I don't know the details of what exactly the supremes did allow them to patent. As I said, if it's the novel lab or field techniques that allow testing for the BRCA1 gene, that may be fair enough. But if it's the complementary DNA sequence itself, that's really no different to patenting the BRCA1 gene (which the supremes disallowed).

An analogy might be a court saying that you aren't allowed a patent on the 23rd page of "Wuthering Heights", but letting you obtain a patent on the same with all occurences of the words "The" and "A" deleted. Complementary DNA is the original DNA with sequences known as introns deleted.

Nigel 11
Silver badge


If they've managed to keep a patent a single string of complementary DNA, then they've pulled a blinder on the supremes. I don't even work in life sciences, but I know that's a re-coding of the original DNA with some bits deleted. So it surely ought to be as un-patentable as the original human gene.

If they're the company that first worked out HOW to do this in a lab, perhaps they deserve a patent for the laboratory technique (though in principle, they're just using the same mechanisms that nature evolved).


Red Hat: We do clouds at one third the cost of VMware

Nigel 11
Silver badge

ZFS is coming to Linux

ZFS is coming to linux - it escaped Oracle's control.


As usual for open source there's healthy competition between the ZFS port and that new kid on the block called btrfs. And as usual with filesystems, especially complex ones, it'll be a few years yet before either is ready for serious production work.


Boffins fire up old dish to send interstellar SMS

Nigel 11
Silver badge

Re: Why the hell would they do that?

There are a lot of other problems that have to be solved to build a close-to-lightspeed starship, including an improbably large initial mass to payload ratio. Realistically, they'd need a MUCH longer lifespan, high radiation tolerance, and be happy to journey at 0.001c, so they're unlikely to be showing up for quite a few centuries yet.

But yes - the flaw in the strong anthropic principle is that the universe is NOT perfectly tuned for human beings, but rather for creatures that measure their lifespans in milennia. If such can exist ... otherwise it's not well-tuned for starfaring civilisations at all. We do have trees that have lived a few milennia, and funghi that have lived maybe twenty times longer ... and if the funghi were/are conscious, could we ever know it?

Then there's the possibilities for our Silicon AI children to clock slower than their parents rather than faster. At which point the Fermi paradox again kicks in. Where are the alien AIs?


Young blokes blinded by video-game addiction: THE FACTS

Nigel 11
Silver badge

Depends what you are simulating

It depends now much you need to experience the neural input of real life physics (kinetics, mostly). For piloting a large ship, a simulator is virtually the same as reality. For an airliner it's close, although there are situations close to disaster where kinetic forces can be felt and reacted to. For a fighter aircraft or racing car, it's far less close. And so on.


Scientists investigate 'dark lightning' threat to aircraft passengers

Nigel 11
Silver badge

Re: re. "... electrons and positrons forced to interact.."

Created as positron / electron pairs by gamma radiation or high-energy electrons. Rest mass of an electron is 0.511eV, so anything much above 1MeV can do it. Electric potential of a thunderstorm is 100s of MV.


So, Windows 8.1 to give PC sales a shot in arm? BZZZZT, wrong answer

Nigel 11
Silver badge

Re: Win 8.1 - It's not a shot in the arm

I was thinking knee. Or maybe groin. Head, if they EOL Windows 7.

"Can I buy one with Windows 7"


"Do you sell anything with Windows 7"?


"Oh" (looks disappointed, wanders off to look at the TVs or kitchen appliances).

Nigel 11
Silver badge

Mature market

For every technology, the market eventually becomes mature and saturated, and the result is that volume of sales decreases to the replacement level because New and Old are approximately equal if Old still works at all. Witness kitchen appliances. Automobiles. Audio systems.

PCs have reached this point. Previously they became obsolete in three years, now they become worn out in 6-9 years, so a 2-3 fold shrinkage in volume is completely predictable (and tough for manufacturers). In contrast tablets haven't yet saturated their market, neither are they a mature technology. Most folks have worked out that PCs and tablets aren't competing products, any more than a car and a bicycle are competing products. PCs are for creating content. Tablets are for consuming content. Many of us have both.

Nigel 11
Silver badge

Re: +1 avoiding an upgrade

You have to make an image backup of the HDD to another HDD before you do a Windows swap, because Windows is perfectly capable of borking the disk into complete unrepairability if you try to boot it in a new hardware environment. Microsoft doubtless considers this a desirable feature, not a bug.

In contrast, I've yanked a linux disk out of an AMD multi-core system and booted it on an utterly different Intel single-core system with no trouble. I also had the assurance that linux / and /home are separate partitions, so / was expendable and /home wouldn't be mounted after commenting out its line in fstab.

Nigel 11
Silver badge

Re: Classic Coke

Can't speak for Macgyver, but I have the same problem. The same hardware works perfectly fine when loaded with Windows 7. Install Windows 8, and it's fubar on the networking front. Repeat-tested on two instances of the same hardware.


You've seen the Large Hadron Collider. Now comes the HUGE Hadron Collider

Nigel 11
Silver badge

Re: >"a few more minutes"

"The bad news is that it's dropped into the earth's core and is now irreversibly eating our planet. The good news is that it'll take the next three billion years, give or take a few million."

I fear no-one woud care much even if it were just three thousand years.

Nigel 11
Silver badge
Thumb Down

Re: basic science

What did (Prof. Sir. ) Neville Mott get out of studying the field effect in the 1930s? At the time it was just theoretical physics. It wasn't even the first sort of transistor we made ....

Curiosity has survival value, or at least always has done until now. If it hadn't, we'd have evolved out of it. (And I'm not even sure we're the most curious species. If there were a way to normalize curiosity by intellectual capacity, I'm sure cats would beat us).

Nigel 11
Silver badge

Re: If you want to bash Positrons & Electrons...

Doesn't work. The trouble is that charged particles emit electromagnetic radiation when you change the direction they are moving. The higher the energy of the particles and the tighter the bend, the more they do it. You reach a limit where it's not feasible to pump in energy any faster than the particles are shedding it, and the only way around that is a bigger ring (or ideally a straight line for zero losses, which is where this discussion started).

Nigel 11
Silver badge


By the way, the control codes at CERN really DO have to include a calculation of the phase of the moon. The earth suffers elastic tidal distortion, enough to change the alignment of the LHC to a significant extent.

Nigel 11
Silver badge

Re: Earthquakes

The difference is that they're relatively small and rigid structures that can survive the gradual distortion of the ground they are built on bt anything less than a truly huge earthquake. Whereas a LINAC 10km long that has to be dead straight might end up bent out of alignment, which would ruin it.

A picture from California is worth a thousand words


Nigel 11
Silver badge

Why not? It's no different to the everyday usage of "nuke it"!

Doesn't everyone know about natural cosmic rays up to10^19 eV, and the number of them that have interacted with the sun in the last 4 billion years? (Hint: the sun is BIG). If really high energy particles had any untoward effects on large collections of matter, we wouldn't be here to talk about it. (Or the fun alternative, maybe they once DID have dramatic effects on the pre-universe, and that's WHY we're here talking about it! )

Nigel 11
Silver badge

Re: meanwhile in the texas desert

That's a bit like upgrading from a Bentley to a Bugatti, when you know that what you really need is a supersonic jet. Not a big enough advance to be worth paying that much for. The LHC is the biggest ring we'll build in any forseeable future.

Linear accelerators are the most obvious way we might get a really big advance. In outline ... an electric field of a million volts per meter, over ten kilometers, is 10GV. Subject a proton to that and because it's ~2000 times more massy than an electron, that's ~20TeV. Now work on higher field strengths ... none of this is impossible, it's just unknown territory in engineering terms.

For a rather further-fetched idea, look up PASER (and consider where we are today, starting from some theoretical 1930s papers on the field effect ... with a big detour via germanium junction transistors).


Asus FonePad: You may feel a bit of a spanner

Nigel 11
Silver badge

Bigger screen + much bigger battery = win

Unless you start to notice the extra weight?


We're losing the battle with a government seduced by surveillance

Nigel 11
Silver badge

Re: Time to pack up and leave

those places will probably not give you the kind of lifestyle you are used to.

Switzerland looks good for a decade or two longer, if you can hack the exchange rate. Unfortunately, it's surrounded.

I find the omnipresent surveillance nightmare more troubling than any other SFnal visions of the near future. Soon enough, we will be living in a world where everything is networked, and everything has eyes and ears and a CPU, and no-one will be willing or even able to break the rules. I can't see a way past that trap. And then we'll be no more able to react to changing circumstances than insects, and the subsequent fall will be deeper than any previous fall in history. Especially if by the time it happens, there is no longer any place outside "the empire" to flee to or to be invaded by.

When the Roman Empire fell, the people left in England lost the technology of throwing pots on a potter's wheel. This, even without nukes and surveillance.


'THINNEST EVER' spinning terabyte beauty slips out of WD fabs

Nigel 11
Silver badge

Re: Sigh

In most contexts the two are close enough to be treated as ~equal. In software documentation concerning (mostly) disk partition tables and related entities, they take care to get it right. Often, command lines use abbrteviations m for 10^6 and M for 2^20, rather than M for decimal and Mi for binary, but the documentation spells it out.

Nigel 11
Silver badge

Scientists will also disagree, because M G T etc. are SI prefixes defined as powers of ten. The correct prefixes for 2^10 2^20 ... are indeed ki, Mi, Gi, Ti, ...

A 4k7 resistor was 4700 Ohms, and a "megohm" resistor 1,000,000 Ohms, before the word "byte" had been coined.


Windows NT grandaddy OpenVMS taken out back, single gunshot heard

Nigel 11
Silver badge

Archaeologist-programmers, anyone?

A very necessary skill on a starship crew ....


Copyright troll Prenda Law accused of seeding own torrents

Nigel 11
Silver badge

Re: likely to cost an attorney his law license

By the time this is over I expect they'll be looking for a career at the bar in front of them. But they'll have trouble buying a drink there, let alone landing a job.


Police 'stumped' by car thefts using electronic skeleton key

Nigel 11
Silver badge
Thumb Up

@Lee D Re: Only a matter of time.

Wish I could upvote that a hundred times over. Why, why, WHY do people see any advantage in a wireless "key" rather than a contact "key"? Same as paying more for notebooks lacking a wired network socket, I guess.

Driving a junker works well. Someone recently radio-unlocked my 12-year-old car - presumably the tech to break 12-year-old radio security is now available for less than the cost of a new key? Anyway, they couldn't find anything much worth stealing, neither car nor contents.


Boffins develop 'practically free' sulphur-powered batteries

Nigel 11
Silver badge

Re: Superabundant sulpher

Actually a major source of unwanted sulfur is the refining of crude oil and the purification of natural gas.

On the other hand, if the oil and gas industry didn't land us with heaps of sulfur to get rid of, gypsum (a common mineral) is Calcium Sulphate.

Nigel 11
Silver badge

Re: Lucas Electric Vehicles,1980s called, your sodium-sulphur battery experience is needed

Are you confusing hydrogen sulphide? (which is about as toxic as hydrogen cyanide, except that you're more likely to notice the rotten-eggs smell in time to make a hasty escape).

Sulfur Dioxide isn't in that league, and there are many things much more toxic than cyanide.

Nigel 11
Silver badge

Renewable energy storage

If the raw materials are plentiful and cheap, you don't need a large energy density. Imagine that you could make a battery out of (say) Silicon dioxide and Calcium carbonate. You'd just pile up enough of it to solve the problem. It's only if the battery has to move its own mass around, as in a 'leccy car, that energy density becomes critical.

Sulfur is cheap and plentiful, Lithium rather less so.

Nigel 11
Silver badge

Re: But note it's only 2x better than Li ion. So...

The general problem with a battery is that it involves surface chemistry, but you need a lot of extra bulk material to give the surfaces some mechanical integrity. This is why having a reliable solid-electrolyte chemistry would be a big step forward. If the electrolyte is solid wlll add to the mechanical integrity of the whole.

For NiMH cells (whch I read up about), they are constructed much like a toilet roll. A long thin roll of charge-storage sandwich. You get a higher storage capacity by making the sandwich thinner, but thinner means greater charge leakage, and a law of diminishing returns sets in rapidly for an AA cell packing more than 2700mAh.

Nigel 11
Silver badge

Re: Lucas Electric Vehicles,1980s called, your sodium-sulphur battery experience is needed

And you don't want to be in downwind proximity to a large pile of burning Sulfur. Not the most toxic of materials, but most definitely unpleasant ( S + air -> SO2 + water -> H2SO3 + more air -> H2SO4).

I read about a proposal to use sodium-sulfur batteries in electric cars in (I think) the 1980s, and I thought it was one of the craziest ideas I'd ever read. I thought, like putting a shock-sensitive detonator in a petrol tank. (Now they're talking about CNG ... at least a CNG cylinder can't not be tough).

Nigel 11
Silver badge

Re: excellent

According to wikipedia http://en.wikipedia.org/wiki/Nickel%E2%80%93iron_battery

Due to its low specific energy, poor charge retention, and high cost of manufacture, other types of rechargeable batteries have displaced the nickel–iron battery in most applications

Lots more interesting stuff. No mention of Exide. The batteries are out there and in use, in places where the weight of the battery is less important than its reliability or ruggedness. They're under review for renewable energy storage. For automotive use, weight is important, as is energy retention (cars are left unused for weeks, occasionally months) and for a fuel-driven car the battery is dead weight except for the few seconds when you are starting the engine. Doesn't sound like a competitor for lead-acid to me.


Smart TVs riddled with DUMB security holes

Nigel 11
Silver badge

Re: Where are the attacks...?

Just as long as it's not SO smart that one can't simply "forget" to connect it to the internet.

Of course, that's kind of begging the question of how much longer broadcast TV will exist. I suspect Digital TV may go the way of analogue TV within a couple of decades. Internet TV or no TV thereafter.


Space boffins, oil giants, nuke plants 'raided' by MYSTERY code nasty

Nigel 11
Silver badge

Another idea

It's like bio-warfare. The Chinese(*) wrote it, but it escaped, and is now propagating itself beyond their ability to "recall" it. Scary.

(*) or anyone else, possibly including some near-autistic kid living in a council flat near you.


Dell bucks PC market tumble with Haswell business systems

Nigel 11
Silver badge

Re: Faster access to components?!

Funny, on the PCs I maintain today I've never needed anyting other than a #1 cross-head.

I do remember that early Dells were assembled with a nightmare mix of Philips, flat, Torx, hex-head, and OMG tamper-proof. But that was a LONG time ago.

Nigel 11
Silver badge

Faster access to components?!

Why is it that Dell (and other "corporate" PC vendors) hold to the idea that it's quicker to get at a machine's innards if you don't need a screwdriver? My experience has always been that by the time you've worked out which tricky little catches to release and what to slide in which direction, you could have replaced a disk drive in a drive bay in a well-designed machine where it's held in place with screws.

And shortly after you've worked it out, you'll notice blood dripping from a finger, and have to take a break to find a sticking-plaster.

(Are there really any service engineers out there so dim that they can't use a screwdriver? )


Microsoft parades Windows 8.1, the version you may actually want

Nigel 11
Silver badge

Re: Why save the PC?

I also think MS has too much negative sentiment associated with its brand to really excite large portions of the market.

And when did IBM last excite large sections of the market? What percentage of people outside IT even know what IBM does? And ... so what?

Microsoft's bread and butter is desktop PCs used by businesses or for business. For content creation not content consumption. If they carry on down the road they are on, someone is going to eat their core business the way Linux(*) is eating the iPhone.

By the way, I don't care. I almost hope Microsoft does go the same way as Digital. Those whom the gods would destroy, they first make mad. Telling your customers that they're wrong and should <go away> is a symptom of corporate madness. It's also what Digital did more and more, until their fall.

(*) Android. It's Linux under the skin. Though the moral would be the same even if it weren't.

Nigel 11
Silver badge

Re: Not really fixing any of the problems

One danger MS has now is they've split their customers into two groups, those who prefer a traditional desktop environment and those who prefer Metro.

Linux solved that problem ages ago. When you log in you select the UI you prefer from a list of those installed on your system. If your UI of preference isn't on the list and you have admin access to your machine, you download and install the one you want. I bitched like hell when Gnome 3 destroyed Gnome 2 rather than being able to install them both side by side ... that's NOT THE LINUX WAY ... but the open-source community fixed this brain damage both possible ways, with Mate (a fork of the original Gnome 2) and Cinnamon (a new but similar UI running atop Gnome 3 libraries).

But Microsoft think there must be one and only one UI, that they tear up and replace with something utterly different on a whim. And the Windows 8 UI is frankly about as loveble as Jimmy Saville. The more one learns ....

Nigel 11
Silver badge
Thumb Down

At the moment I have five windows visible on my screen. That's how I want to work. I don't want anything to ever go full-screen unless I click on the full-screen button - which I never do, because no application I run needs 1920 x 1200 pixels. Several more windows are hidden but I can bring them to the foreground with one click and return them to underneath with another one click. I don't have to touch the keyboard to context-switch.

Microsoft think I should be working differently.

If Windows 7 ever goes away, I'll find a job that doesn't involve ever having to interact with a Microsoft system at all.


Can lightning strike twice? Intel has another crack at Thunderbolt

Nigel 11
Silver badge

Re: A solution looking for a problem.

My thought too. For now, USB3 is good enough for almost everything, and eSATA good enough for the exception.

But maybe Intel are looking a long way ahead. When memristor technology arrives (dirt-cheap randomly addressible nonvolatile RAM - OK I'm an optimist), how are you going to connect your 1Tb memory stick in the year 2020? Hint: USB3 will offer only a small fraction of the attainable speed.

Also think about why USB2 beat Firewire (which was faster).


Internet pioneer Vint Cerf predicts the future, fears Word-DOCALYPSE

Nigel 11
Silver badge

Encryption is the real danger

If anyone wanted to read a non-encrypted document in some old format or other, I doubt that they'd need to be qualified to work at GCHQ in order to "break" the (non-)code. It's just reverse-engineering something that actually isn't designed to conceal.

Strong encryption, on the other hand, means that once the decryption key is gone, so is the document.


Review: Philips Hue network enabled multicolour lightbulbs

Nigel 11
Silver badge

Colour temperature

Colour temperature is a stupid attempt to sum up a spectrum in one number. What you really need is a spectroscope. You'll then see that an incandescent bulb of any sort emits a nice smooth spectrum (which can indeed be derived from the filament's temperature). What comes out of a CFL is mostly green and all lumps and bumps, and what comes out of an LED is a rather smoother two-humped distribution with an unnaturally high amount of blue.

Our eyes are evolved to work best with a single-hump spectrum a.k.a. sunlight. A halogen bulb comes closest, but is not as hot as the sun so it's a bit deficient in blue and violet. An old-fashioned "yellow" filament bulb generates less green and virtually no blue and violet, but the spectrum is still smooth.

There's also mounting evidence that blue and violet light is involved in maintaining our bodies' circadian rhythms. Yellowish lighting for night-time use was probably a very sound non-choice, and the medical impact of switching to CFLs and LEDs may yet to be appreciated. If anyone is suffering from insomnia, I'd suggest it's worth a try to kick out all the CFL and LED bulbs from your house, and run halogen bulbs on a dimmer in the evening to suppress their blue output. Conversely on grey winter mornings, a full-on halogen bulb or even the bluer LED illumination may be a very good thing.

Nigel 11
Silver badge
Thumb Down

Re: Why not intelligent sockets?

The difference in wattage between CFL or LED and incandescent is so great that there's no way they aren't saving electricity. Less than is advertized, though, for two reasons, one of which you'd not spot with any measurement of electricity going into the bulb.

1. CFL light spectrum is awful, and we compensate by upping the brightness. CFL warm-up time likewise. LED is far better and zero warm-up time.

2. "Waste heat" isn't all wasted. In winter, part heats the room, and the rest the space above. If you eliminate this heat source, the central heating has to supply the noticeably missing part(s). And in UK homes, lights are turned on for a much greater time in winter than in summer (short vs. long daylight hours).

Energy-saving bulbs make far more sense in the tropics, where they also save on airconditioning bills (i.e. extra electricity being used to pump the completely unwanted waste heat out of one's living quarters).

Anyway, give LEDs a few more years' development, and they'll probably become at least as good as halogen incandescent lighting.

Nigel 11
Silver badge

Re: blutooth

It ought to be possible to produce a cheap version of powerline networking, with a bandwidth of a few kilobits per second, for the purpose of controlling domestic equipment. Get it ISO standardised, get the price down to a few pennies per chip, and build them into every appliance right down to the light bulb level. (Or into the ceiling roses or into bayonet to ES adapters! )

Just give us a physical disable mechanism, so technophobes or safety-critical devices can't be hacked!

Nigel 11
Silver badge

Re: "There's no need to change your light fittings - you can buy screw to bayonet adapters"

For incandescent bulbs, I preferred screw. The problem is that the heat makes the plastic of the lampholder become brittle, and in my experience the bayonet holders are far more prone to breaking when you try to remove a blown bulb. Should be a thing of the past with flourescents and LEDs. Screw-fit bulbs working loose was probably caused by thermal cycling, so that is also probably a historical problem.

I also wonder how long it will be before designers realize that if an LED bulb will last 25 years, why make it a replaceable unit? Isn't it better to integrate the low-voltage PSU and the LEDs permanently into a metal light fitting? The light fitting would also provide a better heatsink for the LEDs, extending their life and/or increasing their brightness.


Germans purge selves of indigestible 63-letter word

Nigel 11
Silver badge

Re: Donaudampfschifffahrtsgesellschaftskapitaenswitwe

I've now got to ask - how do Germans indicate a diaresis, given that the usual method of doing so looks exactly like an umlaut?

Nigel 11
Silver badge
IT Angle

Re: This thread is full of words that look like variable names I've seen.

Awful code? Or just code written by a person whose first language is not English, whose idea of a good variable name is therefore not the same as yours?

Nigel 11
Silver badge

Re: There is even an IT angle

Maybe with more CPU cycles, they could start analyzing words with prefixes and suffixes, and put a wiggly brown line under words that might be OK but aren't actually in its dictionary. (Ie, words that break down as common prefixes and suffixes and something that is a known word in the middle.)

Nigel 11
Silver badge

Agglutinative languages

German (and Turkish and others) basically don't put spaces in a noun phrase, so there's no real significance to the length of a "word" and you're free to invent your own. Worth noting that spaces are actually a relatively modern development in writing. Theancientsdidn'tusespacesatall.

Nigel 11
Silver badge

Re: antidisestablishmentarianism...

My thought too. Unlike most lengthy detritus in the dictionary, this word is actually useful (and has been so for centuries). If it didn't exist, political discourse would require that it be invented.


Quantum boffins send data ACROSS TIME AND SPACE

Nigel 11
Silver badge
IT Angle

Re: look ma, no hidden variables

Does superluminal signalling automatically imply time travel?

I've read that it does. Interestingly, it's the IT angle of time travel (even if restricted to information only) which seems to me the greatest paradox. The problem is that if you can send even as little as one bit back in time, you can arrive at the result of any convergent iterative process in the time taken to compute a single iterative step (by sending the result of that iteration back in time to replace the initial approximation).

It's only a slight stretch to claim that such a computer would inevitably transform line noise into a strongly superhuman, perhaps ultimate, intelligence. So akin to the Fermi paradox, where is IT?


Inside Intel's Haswell: What do 1.4 BEELLION transistors get you?

Nigel 11
Silver badge


Am I the only person surprised that Intel hasn't used a bigLITTLE design? (ie, one with a much-simplified core for housekeeping when there's very little going on, sharing state with a much faster core to which it would hand over when things get too busy). Can they dynamically shut down so much of a core that they don't actually need to use silicon real-estate for a separate housekeeper-core architecture?

